PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30138.m003918
Common NameLOC8264678, RCOM_1467360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family Dof
Protein Properties Length: 313aa    MW: 34141.4 Da    PI: 7.3548
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30138.m003918genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.1e-393190261
         zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                   +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s
  30138.m003918 31 NQQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRS 90
                   6899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-253084IPR003851Zinc finger, Dof-type
PfamPF027013.0E-333389IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6743589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MQDIHSIGGG GRLFSGGGGG DRRLRAHHHQ NQQALKCPRC DSLNTKFCYY NNYNLSQPRH  60
FCKNCRRYWT KGGVLRNVPV GGGCRKTKRS KPKHTTTTTT NSTITAPTIS TNTSTILAQE  120
EERKSSNSHS SSESSSLTAT NTATGLEAAS SSASATTNIL NNGIGESKLY VHPNTNTTSF  180
EHGLLEQESD CGIFSEIASL TSLITSSSND HLQFGFGNLM TQHSLENNQQ WHQQQKMVGI  240
CGQNDMAGGL VDQTVHIELS ALQINDRSGK GGPLDWQASG GDQSLFDLPN AVDQTYWSQS  300
QWTDQDQPTL YLP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1917GGRLFSGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002514602.10.0PREDICTED: dof zinc finger protein DOF5.4
TrEMBLB9RLI30.0B9RLI3_RICCO; Putative uncharacterized protein
STRINGPOPTR_0012s12670.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.17e-33OBF binding protein 4